Cat: IPD-X12992

Recombinant Human VEGF-C Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VEGF-C

  • 简介

    The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (196a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Vascular Endothelial Growth Factor C; VEGF-C; Flt4 Ligand; Flt4-L; Vascular Endothelial Growth Factor-Related Protein; VRP; VEGFC

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49767

  • Expression Region

    F32-R227

  • AA Sequence

    FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

  • Protein Length

    Partial

  • Molecular Weight

    25-30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Vascular Endothelial Growth Factor C (VEGF-C) is a pivotal protein involved in lymphangiogenesis, the process of forming new lymphatic vessels, and is a key regulator of endothelial cell function. Its role in promoting lymphatic endothelial cell proliferation and migration has made it a significant focus of research in both normal physiology and pathological conditions, such as cancer, inflammation, and lymphedema. In the context of tumor biology, VEGF-C is particularly notable for its capacity to facilitate metastasis by enhancing lymphatic spread of cancer cells, which underscores its potential as a therapeutic target. Recombinant VEGF-C protein studies have been instrumental in elucidating the molecular mechanisms underlying lymphangiogenesis and have paved the way for the development of novel therapeutic strategies aimed at modulating this process. Additionally, the exploration of VEGF-C’s interaction with its receptors, VEGFR-2 and VEGFR-3, and subsequent signaling pathways has highlighted its importance in vascular biology. Understanding the functional aspects of VEGF-C through recombinant protein studies not only contributes to a deeper comprehension of vascular development but also offers insights into innovative interventions for diseases characterized by aberrant lymphatic function. This has spurred interest in creating VEGF-C-based biomolecules or inhibitors that can regulate its activity, fostering a burgeoning field of research dedicated to targeting lymphangiogenesis therapeutically. As such, the study of recombinant VEGF-C continues to be a critical area of inquiry with wide-ranging implications in oncology, regenerative medicine, and beyond.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US