Analytical Data
-
Gene name
DDX19A
-
简介
The DDX19A protein is an ATP-dependent RNA helicase that plays a crucial role in unwinding single- and double-stranded DNA in the 3'-5' direction. It is actively involved in DNA replication and repair by recruiting DNA2 to aid in 5' end resection during double-strand break repair. DDX19A Protein, Human (His-SUMO) is the recombinant human-derived DDX19A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Application
-
Alternative Names
ATP dependent RNA helicase DDX19A; ATP-dependent RNA helicase DDX19A; DDX19 like protein; DEAD box protein 19A
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUU7-1
-
Expression Region
M1-N478
-
AA Sequence
MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
-
Protein Length
Full Length of Isoform-1
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX19A, a member of the DEAD-box protein family, plays a critical role in various cellular processes, including RNA metabolism, ribosome biogenesis, and gene expression regulation. Due to its ATP-dependent RNA helicase activity, DDX19A is involved in RNA splicing, transport, and degradation, making it essential for maintaining cellular homeostasis. Dysregulation of DDX19A has been implicated in several diseases, including cancer and viral infections, highlighting its potential as a therapeutic target. Research on DDX19A recombinant proteins is crucial for understanding its structural and functional properties. Characterizing these proteins can provide insights into their mechanisms of action and interactions with other cellular components. Advances in recombinant protein technology enable the production and purification of DDX19A in substantial amounts, facilitating detailed biochemical and biophysical studies. Such research not only contributes to our understanding of the fundamental biological processes governed by DDX19A but also opens avenues for the development of novel intervention strategies in related diseases. Overall, the investigation of DDX19A recombinant proteins is a promising area of study that holds potential for both basic research and therapeutic applications.











