Cat: IPD-X36796

Recombinant Human GSTP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GSTP1

  • 简介

    The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (His) is the recombinant human-derived GSTP1 protein, expressed by E. coli , with N-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P09211

  • Expression Region

    P2-Q210

  • AA Sequence

    PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    25-30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GSTP1 (Glutathione S-Transferase Pi 1) is a member of the glutathione S-transferase (GST) family, which plays a crucial role in cellular detoxification processes by catalyzing the conjugation of glutathione to a variety of toxic compounds, including xenobiotics and endogenous metabolites. Research into GSTP1 has gained significant attention due to its involvement in drug metabolism, cancer progression, and resistance to chemotherapy. Elevated levels of GSTP1 have been detected in various cancers, making it a potential biomarker for tumor diagnosis and prognosis. Moreover, its role in protecting cells from oxidative stress implicates GSTP1 in various pathological conditions, including neurodegenerative diseases and inflammatory disorders. The recombinant expression of GSTP1 allows for detailed studies into its enzymatic function, structure, and interaction with substrates and inhibitors, facilitating the development of GSTP1-targeted therapeutics. Understanding the mechanisms by which GSTP1 contributes to drug resistance and cancer biology is critical for improving treatment strategies and patient outcomes in cancer therapy.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US