Analytical Data
-
Gene name
Anionic trypsin
-
简介
Anionic trypsin (serine protease 2, PRSS2) is a member of trypsin family of serine proteases which is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. PRSS2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. PRSS2 potentially participating in the degradation of type II collagen-rich cartilage matrix. Anionic trypsin protein, Dog (His-SUMO) is the recombinant dog-derived Anionic trypsin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Application
-
Alternative Names
; Anionic trypsin; EC 3.4.21.4
-
Species
Dog
-
Source
E. coli
-
Tag
N-His;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06872
-
Expression Region
I24-S247
-
AA Sequence
IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS
-
Protein Length
Full Length of Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Anionic trypsin, a serine protease primarily found in the pancreas, plays a pivotal role in protein digestion by cleaving peptide bonds at the carboxyl side of lysine and arginine residues. Its physiological significance extends beyond digestion, as it is involved in various biological processes, including cell signaling and immune responses. The recombinant production of anionic trypsin has gained attention due to its potential applications in biotechnology and pharmaceuticals. Traditional extraction from animal sources raises ethical concerns and poses risks of contamination, prompting researchers to explore alternative methods for obtaining this enzyme. Genetic engineering techniques enable the efficient production of anionic trypsin in microbial hosts, allowing for large-scale production while ensuring high purity and activity. Additionally, understanding the enzyme's structure-function relationship can lead to the design of specific inhibitors or activators, which may have therapeutic implications for diseases related to protease dysregulation. The research on recombinant anionic trypsin thus holds promise not only for advancing our understanding of proteolytic enzymes but also for developing novel biotechnological applications in diverse fields, including drug development and food processing.
