Cat: IPD-X32094

Recombinant E.coli Protease 7/OmpT Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Protease 7/OmpT

  • 简介

    Protease 7, or OmpT, displays unique proteolytic capabilities, cleaving diverse substrates like T7 RNA polymerase, ferric enterobactin receptor protein (FEP), and protamine. With specificity for paired basic residues, it selectively targets substrates with such motifs, highlighting its pivotal role in diverse biological processes and protein regulation. Protease 7/OmpT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Protease 7/OmpT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ompT; Z1931; ECs1663; Protease 7; EC 3.4.23.49; Omptin; Outer membrane protein 3B; Protease A; Protease VII

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    N-His;N-SUMO

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P58603

  • Expression Region

    S21-F317

  • AA Sequence

    STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Protease 7, also known as OmpT (Outer Membrane Protein T), is a member of the type 1 serine protease family and is primarily found in the outer membrane of certain Gram-negative bacteria, including Escherichia coli. This protein plays a crucial role in the bacterial life cycle by participating in the degradation of peptide bonds, which is essential for nutrient acquisition and regulation of protein turnover. The ability of OmpT to cleave various substrates has garnered significant interest in the fields of microbiology and biotechnology, as it can be utilized in the development of therapeutic agents and diagnostic tools. Furthermore, recombinant forms of OmpT have been explored for their potential to enhance the delivery and efficacy of various biomolecules and vaccines, owing to their unique properties. Research into the structural and functional aspects of Protease 7/OmpT has provided valuable insights into its enzymatic mechanisms, substrate specificity, and potential applications in biocatalysis. Understanding the regulation and expression of this protease is also critical, as it could offer novel strategies for combating antibiotic resistance, which is a growing global concern. Given the increasing relevance of biotechnological applications, studies investigating the re-engineering of OmpT for improved performance in diverse industrial processes are actively being pursued. Overall, Protease 7/OmpT represents a compelling target for ongoing research, with implications reaching far beyond its native bacterial context, potentially revolutionizing approaches in drug development and molecular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US