Cat: IPD-X32089

Recombinant Human SENP8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SENP8

  • 简介

    SENP8 protein, a pivotal protease in the NEDD8 pathway, plays a dual role in catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. SENP8's dual functionality underscores its crucial role in regulating NEDD8 modification, impacting various cellular pathways and functions. SENP8 Protein, Human (His) is the recombinant human-derived SENP8 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Sentrin-Specific Protease 8; Deneddylase-1; NEDD8-Specific Protease 1; Protease Cysteine 2; Sentrin/SUMO-Specific Protease SENP8; SENP8; DEN1; NEDP1; PRSC2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96LD8

  • Expression Region

    M1-K212

  • AA Sequence

    MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

  • Protein Length

    Full Length

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SENP8, a member of the Sentrin/SUMO-specific protease (SENP) family, plays a critical role in the regulation of SUMOylation, a post-translational modification that influences various cellular processes including protein stability, localization, and activity. This protease facilitates the maturation and deconjugation of SUMO peptides from target proteins, thus modulating their functions. The dysregulation of SUMOylation has been implicated in several diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. Research into SENP8 is particularly significant as it has been shown to have a role in cell proliferation and apoptosis, suggesting that it may contribute to tumor progression and metastasis. Understanding the structure and function of SENP8 can provide insights into its potential as a therapeutic target. Recent studies have focused on the purification and characterization of recombinant SENP8 to investigate its enzymatic activity and substrate specificity. These recombinant proteins are crucial for elucidating the underlying mechanisms of SENP8 in cellular pathways and developing inhibitors that could modulate its activity for therapeutic applications. By delineating the biochemical properties of SENP8 and its interaction with SUMO substrates, researchers aim to gain a deeper understanding of its potential roles in health and disease, laying the groundwork for novel treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US