Cat: IPD-X24312

Recombinant Mouse MFG-E8 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MFG-E8

  • 简介

    The MFG-E8 protein plays a critical role in promoting the phagocytic clearance of apoptotic cells in various tissues.As a specific ligand, it interacts with alpha-v/beta-3 and alpha-v/beta-5 receptors and also binds independently to phosphatidylserine-rich cell surfaces.MFG-E8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MFG-E8 protein, expressed by HEK293 , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by the ability of the immobilized protein to support the adhesion of SVEC4-10 mouse vascular endothelial cells. The ED50 for this effect is 35.78 ng/mL, corresponding to a specific activity is 2.795×104 units/mg. Measured by the ability of the immobilized protein to support the adhesion of SVEC4-10 mouse vascular endothelial cells. The ED50 for this effect is 35.78 ng/mL, corresponding to a specific activity is 2.795×104 units/mg.

  • Alternative Names

    Lactadherin; MFGM; MFG-E8; SED1; MP47; BA46; EDIL1; HsT19888; Medin; MFG1; OAcGD3S; SPAG10

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    N-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P21956

  • Expression Region

    A23-C463

  • AA Sequence

    ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    60-75 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MFG-E8, or Milk Fat Globule-EGF Factor 8, is a crucial protein that plays significant roles in various physiological and pathological processes, including immune response, inflammation, and tissue repair. As a member of the EGF (Epidermal Growth Factor) family, MFG-E8 is known for its dual binding properties, allowing it to interact with both phosphatidylserine on apoptotic cells and integrins on phagocytes. This facilitates the clearance of dead cells, thereby preventing excessive inflammation and promoting healing. Studies have shown that MFG-E8 is involved in various disease states, including autoimmune disorders, metabolic diseases, and cancer, making it a potential therapeutic target. Additionally, the recombinant form of MFG-E8 has been extensively investigated for its role in enhancing tissue regeneration, modulating immune responses, and as an anti-inflammatory agent. Research into MFG-E8 and its recombinant protein form has gained traction in recent years, particularly in regenerative medicine and drug development, due to its promising implications in modulating immune responses and promoting cellular homeostasis. As such, understanding the molecular mechanisms and biological activities of MFG-E8 is pivotal for its application in clinical settings, offering avenues for innovative therapeutic strategies to combat various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US