Cat: IPD-X24300

Recombinant Mouse Tetranectin/CLEC3B Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Tetranectin/CLEC3B

  • 简介

    Tetranectin/CLEC3B protein exhibits binding to plasminogen and isolated kringle 4, suggesting potential roles in exocytosis-related molecule packaging and ocular physiology.Its homotrimeric structure emphasizes a propensity for trimeric complexes, highlighting the multifaceted nature of Tetranectin/CLEC3B in diverse molecular interactions and cellular processes.Tetranectin/CLEC3B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tetranectin/CLEC3B protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TN; C-Type Lectin Domain Family 3 Member B; Plasminogen Kringle 4-Binding Protein; TNA

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P43025

  • Expression Region

    E22-V202

  • AA Sequence

    ESPTPKAKKAANAKKDLVSSKMFEELKNRMDVLAQEVALLKEKQALQTVCLKGTKVNLKCLLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQFAIV

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    22-25 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tetranectin, also known as CLEC3B, is a secreted glycoprotein primarily produced in the liver and has garnered significant interest due to its multifaceted roles in various biological processes. It belongs to the C-type lectin family, characterized by its ability to bind to glycoproteins through calcium-dependent mechanisms. Research has shown that tetranectin plays a critical role in tissue remodeling, cell adhesion, and inflammation, making it a potential biomarker for several diseases, including cancer and liver disorders. Additionally, its involvement in the regulation of extracellular matrix components suggests a significant role in wound healing and fibrotic processes. The study of recombinant tetranectin/CLEC3B proteins has facilitated the exploration of their functional capabilities, providing insights into their interactions with cells and other biomolecules. Understanding these interactions is essential for elucidating the protein's physiological roles and its potential implications in therapeutic applications, including targeted drug delivery and regenerative medicine. Current studies are focusing on the detailed characterization of its binding properties and the signaling pathways it influences, aiming to leverage its functions for innovative clinical strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US