Analytical Data
-
Gene name
Creatine kinase B-type/CKB
- Application
-
Alternative Names
rHuCreatine kinase B-type/CKB , His; B-CK; CKB; Creatine Kinase BB
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12277
-
Expression Region
M1-K381
-
AA Sequence
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
-
Protein Length
Full Length
-
Molecular Weight
50.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Creatine kinase B-type (CKB) is an isoform of creatine kinase, an important enzyme that plays a critical role in cellular energy homeostasis by catalyzing the transfer of a phosphate group from ATP to creatine, producing phosphocreatine and ADP. CKB is predominantly expressed in the brain, heart, and various tissues, where it helps to maintain ATP levels during periods of high energy demand. The dysregulation or malfunction of CKB has been implicated in neurological disorders, cardiovascular diseases, and muscular dystrophies. Given its pivotal role in energy metabolism, researchers are increasingly focusing on CKB as a potential therapeutic target and biomarker for these conditions. Recombination technology has made it possible to produce CKB as a recombinant protein, permitting detailed biochemical studies and the exploration of its enzymatic properties. This research may contribute to the understanding of CKB’s contribution to energy balance in health and disease, paving the way for novel diagnostic and therapeutic approaches. Understanding the molecular mechanisms underpinning CKB function and regulation can also enhance our knowledge of muscular and neurodegenerative pathologies, ultimately leading to potential advancements in treatment strategies. The synthesis of recombinant CKB thus serves as a critical tool in elucidating the enzyme's role in various physiological processes and its implications in specific disease contexts.
