Analytical Data
-
Gene name
GST
-
简介
The GST (Glutathione S-transferase) protein is vital for conjugating reduced glutathione to hydrophobic electrophiles, essential for cellular detoxification and defense. GST isoenzymes play a central role in parasites' detoxification systems, indicating a crucial defense role. Additionally, GST may enhance haematin solubility in parasite guts, highlighting its multifaceted contributions to cellular and organismal processes. GST Protein, Schistosoma Japonicum is the recombinant GST protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
rSchGlutathione S-transferase class-mu 26 kDa isozyme; Glutathione S-transferase class-mu 26 kDa isozyme; GST 26; Sj26 antigen; SjGST
-
Species
Others
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P08515
-
Expression Region
M1-K218
-
AA Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
-
Protein Length
Full Length
-
Molecular Weight
25.0-28.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on GST (glutathione S-transferase) fusion proteins has gained significant interest in the fields of molecular biology and biotechnology due to their versatile applications in protein purification, enzyme function studies, and structural biology. GST proteins are a family of enzymes that play a crucial role in the detoxification of electrophilic compounds and are widely distributed across various organisms. The fusion of GST to a target protein facilitates the purification process, as GST can easily bind to glutathione attached to a solid support. This method enhances the yield and purity of recombinant proteins, making it a valuable tool for researchers. Additionally, GST-fusion proteins can help in the characterization of the protein's structure and function, as the GST tag can stabilize the target protein and improve its solubility. The study of GST proteins also extends to their regulatory roles in cellular processes, contributing to our understanding of disease mechanisms, including cancer and neurodegenerative disorders. By investigating the properties and interactions of GST-fusion proteins, researchers aim to develop novel therapeutic strategies and improve biotechnological applications, making this a prominent area of research in modern scientific inquiry.
