Cat: IPD-X24196

Recombinant Mouse Galectin-3/LGALS3 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Galectin-3/LGALS3

  • 简介

    Galectin-3/LGALS3 protein binds IgE and cooperates with integrins α-3 and β-1 to promote endothelial cell migration.It contributes to epithelial cell differentiation and acts as a splicing factor in the nucleus.Galectin-3/LGALS3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AGE-R3; CBP35; GAL3; Gal-3; galactin-3; GALBPCBP35; Galectin3; GALIG; L29; L31; Lectin L-29; LGALS2; LGALS3; Mac-2; MAC2GAL3

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P16110

  • Expression Region

    A2-I264

  • AA Sequence

    ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    35-50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Galectin-3, also known as LGALS3, is a member of the galectin family of proteins characterized by their ability to bind β-galactosides. It plays a crucial role in various biological processes, including cell adhesion, immune response modulation, and apoptosis. Research has increasingly focused on Galectin-3 due to its involvement in numerous pathological conditions, such as cancer, cardiovascular diseases, and fibrosis. Elevated levels of Galectin-3 have been associated with poor prognoses in various malignancies, highlighting its potential as a biomarker for cancer diagnosis and treatment. Additionally, Galectin-3 is implicated in the progression of heart failure and chronic diseases, making it a target for therapeutic interventions. The recombinant expression of LGALS3 enables detailed studies of its molecular functions and interactions, facilitating the exploration of its role in disease mechanisms and the development of Galectin-3 inhibitors for therapeutic applications. Thus, understanding the biological functions of recombinant Galectin-3 can provide insights into its potential as a biomarker and therapeutic target, which may lead to novel strategies for the diagnosis and treatment of diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US