Analytical Data
-
Gene name
VEGF206
-
简介
Vascular Endothelial Growth Factor A (VEGF-A) is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF206 Protein, Human (His) is the recombinant human-derived VEGF206 protein, expressed by E. coli, with N-6*His labeled tag.
- Application
-
Alternative Names
VEGFA; VEGFVascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15692-1
-
Expression Region
A27-R232
-
AA Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
-
Protein Length
Partial
-
Molecular Weight
30.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Related Products
Protein Description
VEGF206 is a recombinant protein that plays a crucial role in the field of therapeutic angiogenesis and tumor biology. Vascular Endothelial Growth Factor (VEGF) is a key regulator of blood vessel formation, and its various isoforms are known to have distinct biological activities. VEGF206, a specific splice variant of the VEGF gene, has garnered attention due to its potential implications in both normal physiological processes and pathological conditions, including cancer. Research suggests that VEGF206 may exhibit unique properties that influence endothelial cell function, permeability, and survival, thus affecting tumor growth and the progression of various diseases. Understanding the expression patterns and functional roles of VEGF206 can shed light on its contributions to tumor microenvironments and may offer insights into novel therapeutic strategies aimed at modulating angiogenesis. Given the complexity of the VEGF signaling pathway, elucidating the mechanisms by which VEGF206 operates is critical for developing targeted interventions, such as biologics or small molecules, that can mitigate aberrant angiogenesis in cancer and other vascular-related disorders. Additionally, the study of VEGF206 may lead to advancements in tissue engineering and regenerative medicine, making it a significant focus of ongoing research aimed at harnessing the therapeutic potential of this protein in clinical applications.
