Cat: IPD-X36642

Recombinant Human ST6GAL1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ST6GAL1

  • 简介

    ST6GAL1, a pivotal enzyme, facilitates glycosylation by transferring sialic acid from CMP-sialic acid to galactose-containing acceptor substrates. ST6GAL1 Protein, Human (HEK293, His) is the recombinant human-derived ST6GAL1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Beta-Galactoside Alpha-2; 6-Sialyltransferase 1; Alpha 2; 6-ST 1; B-Cell Antigen CD75; CMP-N-Acetylneuraminate-Beta-Galactosamide-Alpha-2; 6-Sialyltransferase 1; ST6Gal I; ST6GalI; Sialyltransferase 1; ST6GAL1; SIAT1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P15907

  • Expression Region

    K27-C406

  • AA Sequence

    KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

  • Protein Length

    Lumenal Domain

  • Molecular Weight

    50-60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ST6GAL1, also known as ST6 beta-galactosamide alpha-2,6-sialyltransferase 1, is an important enzyme involved in the biosynthesis of sialylated glycan structures on glycoproteins and glycolipids. Sialic acids are key components that modulate cellular interactions, immune responses, and the stability of glycoproteins. Dysregulation of ST6GAL1 has been implicated in various biological processes, including cancer progression, as it influences tumor cell behavior and the immune evasion mechanisms of cancer cells. Additionally, ST6GAL1 plays a crucial role in neuronal development and function, making its study relevant in neuroscientific research. Recent advancements in recombinant protein technology have enabled the production of ST6GAL1 in heterologous systems, allowing for a better understanding of its function and mechanisms. By studying the recombinant form of ST6GAL1, researchers aim to elucidate its specific role in sialic acid transfer, the resulting effects on glycan structures, and its implications in health and disease. This research holds significance not only for basic science but also for potential therapeutic interventions targeting ST6GAL1 in diseases associated with altered sialylation patterns.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US