Cat: IPD-X31916

Recombinant Mouse Kallikrein-1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Kallikrein-1

  • 简介

    Kallikrein-1 protein is a member of the glandular kallikrein family and plays a vital role in enzyme activity by cleaving the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin..This proteolysis is critical for the production of bradykinin, a bioactive peptide involved in multiple physiological processes, including blood pressure regulation, inflammation, and vascular permeability.Kallikrein-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rMuKallikrein-1, His ; Glandular kallikrein K1; KAL-B; Renal kallikrein; Tissue kallikrein-6; mGK-6

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15947

  • Expression Region

    P19-D261

  • AA Sequence

    PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    34-38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Kallikrein-1 (KLK1) is a serine protease that plays a crucial role in various physiological processes, including blood pressure regulation, the inflammatory response, and fluid balance. It is primarily produced in the kidneys and has been linked to several pathological conditions, such as hypertension, diabetes, and cancer. Research into KLK1 has gained momentum due to its potential as a biomarker for disease diagnosis and prognosis, as well as its therapeutic implications. The recombinant expression of KLK1 provides a valuable tool for studying its enzymatic properties, interactions with substrates, and effects in different biological contexts. Moreover, the availability of recombinant KLK1 enhances efforts to investigate its role in pathophysiological processes and explore its potential as a target for drug development. As scientific interest in KLK1 continues to grow, understanding its structure-function relationship and regulatory mechanisms could uncover novel insights into its role in health and disease, paving the way for innovative therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US