Analytical Data
-
Gene name
S100A8-S100A9 Heterodimer
-
简介
S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its ability to induce IL-6 secretion by A375 cells. The ED50 for this effect is typically 1.511 μg/mL. Corresponding to a specific activity is 661.813 U/mg. Measured by its ability to induce IL-6 secretion by A375 cells. The ED50 for this effect is typically 1.511 μg/mL. Corresponding to a specific activity is 661.813 U/mg.
-
Alternative Names
S100A8/S100A9 Heterodimer
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P05109 (M1-E93) (S100A8)&P06702 (T2-P114)
-
Expression Region
P05109 (M1-E93) (S100A8)&P06702 (T2-P114) (S100A9)
-
AA Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE&TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
-
Molecular Weight
13&15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The S100A8-S100A9 heterodimer, also known as calprotectin, is a complex of two calcium-binding proteins that play a pivotal role in the innate immune response and are found predominantly in myeloid cells. This protein complex is implicated in various pathological conditions, including inflammation, cancer, and autoimmune diseases. It acts as a damage-associated molecular pattern (DAMP) molecule, contributing to the recruitment and activation of immune cells at sites of injury or infection. Research has highlighted its role in enhancing the inflammatory response, modulating cytokine secretion, and serving as a marker for inflammatory diseases. Given its significance, the recombinant expression of the S100A8-S100A9 heterodimer provides a valuable tool for studying its biochemical and biological properties. Understanding its structural dynamics, interaction patterns, and functional mechanisms is crucial for developing therapeutic strategies aimed at regulating inflammatory responses or targeting diseases associated with dysregulated S100A8-S100A9 activity. Consequently, the production of recombinant S100A8-S100A9 not only facilitates academic research but also has the potential to contribute to clinical applications, including diagnostic assays and novel anti-inflammatory therapies.
