Analytical Data
-
Gene name
NRAS
-
简介
NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (N-His) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
GTPase Nras; Transforming protein N-Ras; NRAS; HRAS1
-
Species
Human
-
Source
E. coli
-
Tag
N-8*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01111
-
Expression Region
M1-C186
-
AA Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The NRAS gene, a member of the RAS family of oncogenes, plays a critical role in cellular signaling pathways that regulate cell growth and differentiation. Mutations in NRAS are frequently associated with various malignancies, particularly melanoma, leukemia, and colorectal cancers, making it a significant target for cancer research. Investigating NRAS recombinant proteins has become essential for understanding its functional mechanisms in oncogenesis, as these proteins can help delineate the pathways activated by NRAS mutations. The production of NRAS recombinant proteins enables researchers to study its interaction with downstream effectors and its role in cell signaling. Such studies are vital for the development of targeted therapies, as NRAS mutations are associated with poor prognosis and limited treatment options. Moreover, advanced techniques in molecular biology, such as CRISPR and protein engineering, have facilitated the creation of more stable and functional NRAS variants, allowing researchers to explore drug binding and resistance mechanisms further. Overall, the study of NRAS recombinant proteins provides significant insights into cancer biology and holds promise for the development of innovative therapeutic strategies aimed at targeting NRAS-driven tumors.
