Analytical Data
-
Gene name
Progranulin/PGRN
-
简介
EpCAM/TROP1 protein is a cell surface protein expressed in a variety of epithelial tissues. It plays a crucial role in cell adhesion, proliferation and differentiation. Progranulin/PGRN Protein, Human (HEK293, C-His) is the recombinant human-derived Progranulin/PGRN protein, expressed by HEK293 , with C-10*His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit THP-1 human acute monocyte migration in the presence of 10 ng/mL MCP-1. Measured by its ability to inhibit THP-1 human acute monocyte migration in the presence of 10 ng/mL MCP-1.
-
Alternative Names
Acrogranin; CLN11; GEP; GP88; Granulin; GRN; PCDGF; PEPI; PGRN; Proepithelin; Progranulin
-
Species
Human
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
NP_002078.1
-
Expression Region
T18-L593
-
AA Sequence
TRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
80-95 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Progranulin (PGRN) is a multifunctional glycoprotein involved in various physiological processes, including inflammation, cell growth, and tissue repair. Its significance has escalated in recent years due to its association with several neurodegenerative diseases, particularly frontotemporal dementia (FTD) and Alzheimer's disease, where mutations in the PGRN gene lead to reduced PGRN levels and subsequent neurodegeneration. Research has increasingly focused on the therapeutic potential of PGRN, as reintroducing this protein could mitigate the damaging effects of its deficiency. As a result, the production and characterization of recombinant PGRN have become crucial. Recombinant technology allows for the systematic study of PGRN's biological functions and effects in cellular models, paving the way for developing targeted therapies. Recent advancements in protein engineering also enable the modification of PGRN to enhance its stability and efficacy, further expanding its prospects as a therapeutic agent. Understanding the intricate roles of PGRN in various signaling pathways continues to reveal new avenues for treatment in neurodegenerative disorders, making the study of recombinant PGRN a key area of research in both molecular biology and clinical applications.
