Cat: IPD-X23950

Recombinant Human Progranulin/PGRN Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Progranulin/PGRN

  • 简介

    EpCAM/TROP1 protein is a cell surface protein expressed in a variety of epithelial tissues. It plays a crucial role in cell adhesion, proliferation and differentiation. Progranulin/PGRN Protein, Human (HEK293, C-His) is the recombinant human-derived Progranulin/PGRN protein, expressed by HEK293 , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit THP-1 human acute monocyte migration in the presence of 10 ng/mL MCP-1. Measured by its ability to inhibit THP-1 human acute monocyte migration in the presence of 10 ng/mL MCP-1.

  • Alternative Names

    Acrogranin; CLN11; GEP; GP88; Granulin; GRN; PCDGF; PEPI; PGRN; Proepithelin; Progranulin

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    NP_002078.1

  • Expression Region

    T18-L593

  • AA Sequence

    TRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    80-95 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Progranulin (PGRN) is a multifunctional glycoprotein involved in various physiological processes, including inflammation, cell growth, and tissue repair. Its significance has escalated in recent years due to its association with several neurodegenerative diseases, particularly frontotemporal dementia (FTD) and Alzheimer's disease, where mutations in the PGRN gene lead to reduced PGRN levels and subsequent neurodegeneration. Research has increasingly focused on the therapeutic potential of PGRN, as reintroducing this protein could mitigate the damaging effects of its deficiency. As a result, the production and characterization of recombinant PGRN have become crucial. Recombinant technology allows for the systematic study of PGRN's biological functions and effects in cellular models, paving the way for developing targeted therapies. Recent advancements in protein engineering also enable the modification of PGRN to enhance its stability and efficacy, further expanding its prospects as a therapeutic agent. Understanding the intricate roles of PGRN in various signaling pathways continues to reveal new avenues for treatment in neurodegenerative disorders, making the study of recombinant PGRN a key area of research in both molecular biology and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US