Analytical Data
-
Gene name
AADAC
- Application
-
Alternative Names
AAAD_HUMAN; Aada; Aadac; Arylacetamide deacetylase (esterase); Arylacetamide deacetylase; CES5A1; DAC
-
Species
Human
-
Source
E. coli
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22760
-
Expression Region
P24-L399
-
AA Sequence
PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
-
Protein Length
Partial
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AADAC (avian adenosine deaminase associated with RNA-1) is a member of the adenosine deaminase family and plays a significant role in modulating various biological processes, including RNA metabolism and immune response. Recent studies have highlighted its potential implications in diseases such as cancer and neurodegenerative disorders, due to its involvement in adenosine signaling pathways, which are critical for cellular communication and homeostasis. Moreover, AADAC has been implicated in drug metabolism, particularly in the context of certain therapeutic agents, influencing the pharmacokinetics and efficacy of these drugs. The recombinant expression of AADAC protein has been explored to facilitate in-depth functional studies, enabling researchers to investigate its structure-function relationships, enzymatic activities, and interactions with other molecular partners. This approach not only aids in elucidating the mechanistic roles of AADAC in pathological conditions but also paves the way for potential therapeutic applications, such as designing inhibitors or modulators that can target its enzymatic function. Understanding the biochemistry and biological functions of AADAC through recombinant protein research is essential for developing innovative strategies to manipulate adenosine-related pathways in various clinical settings, thereby providing new avenues for treatment strategies and improving patient outcomes.
