Analytical Data
-
Gene name
PCNA
-
简介
PCNA, an atypical member of the sulfotransferase family, displays notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and minimal catalytic activity towards substrates like L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. Its precise function remains elusive, but PCNA is suggested to participate in drug and neurotransmitter metabolism within the central nervous system (CNS). PCNA Protein, Human (sf9, His) is the recombinant human-derived PCNA protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Application
-
Alternative Names
Proliferating cell nuclear antigen; PCNA; Cyclin
-
Species
Human
-
Source
Baculovirus
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12004
-
Expression Region
M1-S261
-
AA Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
-
Protein Length
Full Length
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Proliferating Cell Nuclear Antigen (PCNA) is a vital protein that plays a significant role in DNA replication and repair. As a processivity factor for DNA polymerase, PCNA enhances the enzyme's ability to synthesize DNA by encircling the DNA strand and maintaining a stable complex during replication. Beyond its classical function in cell proliferation, PCNA is also involved in various cellular processes, including DNA damage response, chromatin remodeling, and the regulation of the cell cycle. Its expression is tightly regulated and often upregulated in proliferating cells, making it a marker for cellular proliferation. The study of PCNA has important implications in cancer research, as many cancer cells exhibit increased levels of PCNA, contributing to their uncontrollable growth. Understanding the mechanisms governing PCNA function and regulation can provide insights into potential therapeutic targets for cancer treatment. Furthermore, the recombinant production of PCNA allows researchers to investigate its structure-function relationship and interactions with other proteins involved in DNA metabolism, paving the way for advancements in molecular biology and cancer therapeutics.











