Analytical Data
-
Gene name
IL-2R beta/CD122
-
简介
IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately)[1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells[2]. IL-2R beta/CD122 Protein, Rat (HEK293, His) is a recombinant rat IL-2R beta (M1-E239) with a C-Terminal His tag, which is produced in HEK293 cells.
- Application
-
Biological Activity
Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 7.957 µg/mL in the presence of 4.0 ng/mL of recombinant human IL-15, corresponding to a specific activity is 6.094×105 units/mg. Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 7.957 µg/mL in the presence of 4.0 ng/mL of recombinant human IL-15, corresponding to a specific activity is 6.094×105 units/mg.
-
Alternative Names
Interleukin-2 receptor subunit beta; IL2RB; High affinity IL-2 receptor subunit beta; CD122
-
Species
Rat
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
NP_037327
-
Expression Region
A27-E239
-
AA Sequence
AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCNFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPVAFRTRPADPKE
-
Protein Length
Partial
-
Molecular Weight
30-49 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-2 receptor beta (IL-2Rβ, also known as CD122) plays a critical role in the immune system by mediating the actions of interleukin-2 (IL-2), a vital cytokine involved in T-cell proliferation and differentiation. The receptor is part of a multi-chain complex that includes IL-2Rα (CD25) and IL-2Rγ (CD132), forming a high-affinity receptor for IL-2, which is essential for T-cell activation and the regulation of immune responses. Research on IL-2Rβ/CD122 is pivotal due to its implications in various immunological conditions, including autoimmune diseases, cancers, and transplant rejection. Understanding the structure and function of CD122 can aid in the design of novel therapeutic strategies aimed at enhancing or inhibiting immune responses. The recombinant protein expression of IL-2Rβ/CD122 offers a valuable tool for studying its biochemical properties and interactions, serving as a potential target for drug development. Furthermore, the exploration of IL-2Rβ signaling pathways can advance our knowledge of immune regulation and the mechanisms behind immune-related disorders, providing insights into potential biomarkers for disease progression and therapeutic outcomes.











