Analytical Data
-
Gene name
SIAE
-
简介
SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (HEK293, His) is the recombinant human-derived SIAE protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Sialate O-Acetylesterase; H-Lse; Sialic Acid-Specific 9-O-Acetylesterase; SIAE; YSG2
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HAT2-1
-
Expression Region
I24-K523
-
AA Sequence
IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
64-77 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIAE (sialic acid-binding immunoglobulin-like lectin) is a key player in the regulation of immune responses and plays a significant role in various biological processes, including cell signaling and pathogen recognition. The study of SIAE recombinant proteins has gained attention due to their potential applications in immunotherapy and vaccine development. SIAE is known to interact with sialic acid, which is a carbohydrate that influences cell interactions and immune evasion by pathogens. Research has demonstrated that SIAE can modulate the activity of immune cells, thereby affecting the overall immune response. By producing recombinant forms of SIAE, researchers aim to better understand its structure-function relationships and to explore its therapeutic potential. This includes examining how SIAE can be utilized in targeting specific immune pathways or enhancing vaccine efficacy by improving antigen presentation or boosting immune responses. Additionally, the study of SIAE's role in diseases such as cancer and autoimmune disorders opens new avenues for targeted therapies. Given the critical functions of sialic acid in immune modulation and disease progression, SIAE recombinant proteins represent a promising area of research with significant implications for developing novel approaches in immunotherapy and personalized medicine.











