Analytical Data
-
Gene name
NAD2
- Application
-
Alternative Names
NADH dehydrogenase subunit 2; nad2
-
Species
Others
-
Source
E. coli Cell-free
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A075XDS2
-
Expression Region
G32-L300
-
AA Sequence
GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL
-
Protein Length
Full Length of Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAD2, or Nicotinamide Adenine Dinucleotide II, is a crucial component of the mitochondrial respiratory chain, playing a significant role in cellular energy metabolism. Research on NAD2 recombinant proteins has gained momentum due to their potential applications in understanding mitochondrial function and related diseases. Mitochondrial dysfunction is linked to various pathologies, including neurodegenerative disorders, metabolic syndromes, and aging. The study of NAD2 not only aids in elucidating the biochemical pathways involved in energy production but also provides insights into the regulatory mechanisms of oxidative phosphorylation. Recombinant NAD2 proteins enable researchers to investigate the protein's structure-function relationship and interactions with other mitochondrial components in vitro. By employing molecular biology techniques, scientists can produce these proteins in sufficient quantities for detailed functional assays and structural studies, thereby facilitating drug discovery and therapeutic intervention strategies for mitochondrial disorders. Consequently, the ongoing research into NAD2 recombinant proteins is vital for advancing our understanding of mitochondrial dynamics and developing innovative treatments for related health conditions.











