Cat: IPD-X31646

Recombinant Mouse Cathepsin W/CTSW Protein,His & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cathepsin W/CTSW

  • 简介

    Cathepsin W/CTSW is implicated in potentially regulating T-cell cytolytic activity, suggesting a role in immune response processes. Recognizing its potential function underscores its significance in immune defense against pathogens. The precise mechanisms of Cathepsin W in T-cell regulation remain an area of interest, highlighting its potential as a key player in immune system function and cellular defense orchestration. Cathepsin W/CTSW Protein, Mouse (His, myc) is the recombinant mouse-derived Cathepsin W/CTSW, expressed by E. coli , with C-Myc, N-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CtswCathepsin W; Lymphopain

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    C-Myc;N-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56203

  • Expression Region

    V126-P371

  • AA Sequence

    VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    35.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Cathepsin W (CTSW) is a member of the cysteine cathepsin family, which plays a crucial role in various physiological and pathological processes, including immune responses, inflammation, and cancer progression. Recent studies have highlighted the significance of CTSW in the regulation of immune cell functions, particularly in T cells and dendritic cells, suggesting its potential as a therapeutic target in autoimmune diseases and immunotherapy. Furthermore, CTSW's involvement in the degradation of extracellular matrix components indicates its role in tissue remodeling and metastasis in cancer. The recombinant expression of CTSW protein has garnered attention for its utility in understanding the enzyme's structure, function, and mechanisms of action. Researchers are increasingly focusing on characterizing the biochemical properties of CTSW and its substrate specificity to elucidate its role in disease mechanisms. Additionally, producing recombinant CTSW allows for the development of novel protein-based therapeutics that could modulate its activity, offering potential strategies for treating various diseases linked to dysregulated cathepsin activity. As such, the study of recombinant CTSW not only advances our understanding of cathepsin biology but also opens up avenues for innovative therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US