Analytical Data
-
Gene name
IL-6R alpha
-
简介
IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Mouse consists of 460 amino acids (M1-R460) with two fibronectin type-III-like domains contained in the N-terminal part (109-214 a.a, 215-313 a.a). Soluble IL-6R (sIL-6R) can be detected in the cerebrospinal fluid, conducts trans signaling by binding IL-6 and dimerized gp130, and exhibits a immune tissue expression property. IL-6R alpha Protein, Mouse (HEK293, His) is soluble form and produced in HEK293 cells with a C-Terminal His-tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 3.014 ng/mL in the presence of 2 ng/mL recombinant mouse IL-6, corresponding to a specific activity is 3.32×105 units/mg. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 3.014 ng/mL in the presence of 2 ng/mL recombinant mouse IL-6, corresponding to a specific activity is 3.32×105 units/mg.
-
Alternative Names
Interleukin-6 receptor subunit alpha; IL-6R-alpha; IL-6R 1; sIL6R; CD126
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P22272
-
Expression Region
L20-P364
-
AA Sequence
LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSSMSLP
-
Protein Length
Extracellular Domain
-
Molecular Weight
50-65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-6 receptor alpha (IL-6Rα) is a crucial component of the interleukin-6 (IL-6) signaling pathway, which plays a significant role in inflammation, immune response, and hematopoiesis. Dysregulation of this pathway has been implicated in various pathological conditions, including autoimmune diseases, chronic inflammatory disorders, and certain cancers. The soluble form of IL-6Rα, which can be generated by alternative splicing or proteolytic cleavage, has garnered interest as a potential biomarker and therapeutic target due to its involvement in pro-inflammatory signaling cascades. Research on recombinant IL-6Rα proteins has expanded our understanding of IL-6 signaling mechanisms and its implications in disease. These proteins are utilized in various experimental applications, including the study of receptor binding, signal transduction, and functional assays that explore the effects of IL-6 in different biological contexts. Additionally, the development of IL-6Rα antagonists, such as monoclonal antibodies targeting the receptor, showcases their therapeutic potential in treating IL-6 related pathologies. Ongoing studies aim to elucidate the precise roles of IL-6Rα in diverse disease states and explore its potential as a therapeutic biomarker or target, highlighting the importance of this research in developing innovative treatments for inflammatory and autoimmune diseases.
