Cat: IPD-X36310

Recombinant Rhesus Macaque IL-6R Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-6R

  • 简介

    IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Rhesus Macaque consists of 365 amino acids (M1-P365) and is produced in HEK293 cells with a C-Terminal His-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Human rhesus IL-6R is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human IL6 . The ED50 for this effect is 73.24 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human rhesus IL6R is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human IL-6 . The ED50 for this effect is 73.24 ng/mL.

  • Alternative Names

    Interleukin-6 receptor subunit alpha; IL-6R-alpha; IL-6R 1; gp80; CD126

  • Species

    Rhesus Macaque

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    XP_001114404.1

  • Expression Region

    L20-P365

  • AA Sequence

    LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP

  • Protein Length

    Partial

  • Molecular Weight

    60-70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-6 receptor (IL-6R) is a crucial component of the interleukin-6 (IL-6) signaling pathway, which plays a significant role in various physiological and pathological processes, including immune response, inflammation, and hematopoiesis. The dysregulation of IL-6R and its downstream signaling has been implicated in numerous diseases, such as rheumatoid arthritis, cancer, and cardiovascular disorders. As a result, the development of recombinant IL-6R proteins has garnered substantial interest in the biomedical field. These recombinant proteins can be utilized as therapeutic agents or as research tools to better understand the IL-6 signaling axis. For instance, soluble forms of IL-6R can act as decoy receptors that bind IL-6, thereby inhibiting its activity and modulating inflammatory responses. Furthermore, the study of IL-6R variants and their interactions with different ligands can provide insights into the receptor's role in disease mechanisms and potential therapeutic targets. Overall, the research into IL-6R recombinant proteins not only expands our understanding of IL-6 biology but also opens avenues for innovative treatment strategies for diseases associated with aberrant IL-6 signaling.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US