Analytical Data
-
Gene name
LSAMP
-
简介
LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuLimbic system-associated membrane protein/LSAMP, His ; Limbic system-associated membrane protein; LSAMP; IgLON family member 3
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13449
-
Expression Region
V29-N315
-
AA Sequence
VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
45-65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Semaphorin-5A (SEMA5A) is a member of the semaphorin family, which plays a crucial role in neural development and axon guidance. This protein is known for its involvement in various cellular processes, including the regulation of neuronal growth cones and the modulation of synaptic connections. Recent studies have highlighted the significance of SEMA5A in neurodevelopmental disorders and its potential association with psychiatric conditions, such as schizophrenia and autism. The research surrounding SEMA5A has gained momentum due to its dual role as a signaling molecule in both the nervous system and the immune system, indicating its broader implications in cell communication. Recombinant SEMA5A proteins have been developed for in vitro studies to elucidate its biological functions, receptor interactions, and downstream signaling pathways. Understanding SEMA5A's mechanisms of action could pave the way for novel therapeutic approaches for neurodevelopmental disorders and other conditions linked to semaphorin signaling dysregulation. Overall, the investigation of SEMA5A and its recombinant proteins is essential for both basic science and potential clinical applications aimed at manipulating neural connectivity and improving outcomes in neurodevelopmental disorders.











