Cat: IPD-X23765

Recombinant Human Collectin-11/CL-K1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Collectin-11/CL-K1

  • 简介

    Collectin-11/CL-K1 is an important lectin in innate immunity, apoptosis, and embryogenesis that recognizes sugars presenting high mannose oligosaccharides with at least one terminal α-1,2-linked mannose epitope protein. It also recognizes fucosylated glycans and lipopolysaccharides. Collectin-11/CL-K1 Protein, Human (HEK293, His) is the recombinant human-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCollectin-11/CL-K1, His; Collectin-11; Collectin Kidney Protein 1; CL-K1; COLEC11

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BWP8

  • Expression Region

    Q26-M271

  • AA Sequence

    QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    30-35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Collectin-11 (CL-K1) is a member of the collectin family of proteins, which play crucial roles in the innate immune response by recognizing a wide range of pathogens. As a collagenous lectin, CL-K1 binds specifically to carbohydrate structures on microbial surfaces, facilitating opsonization and clearance of pathogens. Recent studies highlight its importance in various physiological and pathological conditions, including inflammatory responses, autoimmune diseases, and even cancer progression. Research on CL-K1 has gained momentum due to its potential as a biomarker for disease states and as a therapeutic target. Understanding the structure, function, and interactions of CL-K1 at the molecular level is essential for elucidating its role in immune modulation. Given its unique properties, recombinant CL-K1 protein is being developed for various applications, including vaccine development and as a diagnostic tool. Investigating the mechanisms by which CL-K1 influences immune responses could open new avenues for therapeutic interventions and enhance our comprehension of the immune system's complexities.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US