Analytical Data
-
Gene name
Collectin-11/CL-K1
-
简介
Collectin-11/CL-K1 is an important lectin in innate immunity, apoptosis, and embryogenesis that recognizes sugars presenting high mannose oligosaccharides with at least one terminal α-1,2-linked mannose epitope protein. It also recognizes fucosylated glycans and lipopolysaccharides. Collectin-11/CL-K1 Protein, Human (HEK293, His) is the recombinant human-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuCollectin-11/CL-K1, His; Collectin-11; Collectin Kidney Protein 1; CL-K1; COLEC11
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BWP8
-
Expression Region
Q26-M271
-
AA Sequence
QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Collectin-11 (CL-K1) is a member of the collectin family of proteins, which play crucial roles in the innate immune response by recognizing a wide range of pathogens. As a collagenous lectin, CL-K1 binds specifically to carbohydrate structures on microbial surfaces, facilitating opsonization and clearance of pathogens. Recent studies highlight its importance in various physiological and pathological conditions, including inflammatory responses, autoimmune diseases, and even cancer progression. Research on CL-K1 has gained momentum due to its potential as a biomarker for disease states and as a therapeutic target. Understanding the structure, function, and interactions of CL-K1 at the molecular level is essential for elucidating its role in immune modulation. Given its unique properties, recombinant CL-K1 protein is being developed for various applications, including vaccine development and as a diagnostic tool. Investigating the mechanisms by which CL-K1 influences immune responses could open new avenues for therapeutic interventions and enhance our comprehension of the immune system's complexities.
