Cat: IPD-X36228

Recombinant Human IL-22R alpha 1 Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-22R alpha 1

  • 简介

    IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Human (HEK293, Fc) is expressed by HEK 293 cells and has a transmembrane region (H16-T228) with a Fc tag at the C-terminus[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL-22R-alpha-1; IL-22RA1; CRF2-9; IL22R; IL22R1; IL-TIF-R1; zcytoR11

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N6P7

  • Expression Region

    H16-T228

  • AA Sequence

    HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    60-68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-22 receptor alpha 1 (IL-22Rα1) is a pivotal component of the IL-22 signaling pathway, which plays a crucial role in the immune system and tissue homeostasis. IL-22, a member of the IL-10 cytokine family, primarily functions in the regulation of epithelial cell responses and is important for maintaining the integrity of mucosal surfaces, particularly in the gut and skin. Dysregulation of IL-22 and its receptor has been implicated in various inflammatory diseases, such as inflammatory bowel disease, psoriasis, and other autoimmune conditions. The study of IL-22Rα1 and the development of recombinant proteins have garnered interest for therapeutic applications, as targeting this pathway could modulate inflammatory responses and enhance tissue repair processes. Recombinant IL-22Rα1 proteins can be useful in dissecting the molecular mechanisms of IL-22 signaling, understanding receptor interactions, and exploring potential clinical interventions. By providing insights into receptor biology and facilitating the development of novel therapeutic agents, research on IL-22Rα1 is expected to advance our understanding of immune regulation and its pathological implications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US