Analytical Data
-
Gene name
CLIC2/XAP12
-
简介
The CLIC2/XAP121 protein exhibits the ability to insert into membranes and form chloride channels, and the activity of these channels is pH-dependent. The membrane insertion process appears to be redox-regulated and likely occurs under oxidative conditions. CLIC2/XAP121 Protein, Human (His) is the recombinant human-derived CLIC2/XAP121 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
rHuChloride intracellular channel protein 2/CLIC2, His; Chloride Intracellular Channel Protein 2; XAP121; CLIC2
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15247
-
Expression Region
M1-S247
-
AA Sequence
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
-
Protein Length
Full Length
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLIC2 (Chloride Intracellular Channel 2) and XAP12 (also known as GSTP1 or Glutathione S-Transferase P1) are proteins that have gained attention in recent years due to their potential roles in various cellular processes and diseases. CLIC2 is part of the CLIC family of proteins, which are known to be involved in chloride ion transport and cellular volume regulation. Research indicates that CLIC2 may play a role in cell signaling, apoptosis, and even cancer progression, making it a significant target for understanding these processes at a molecular level. On the other hand, XAP12 is involved in detoxification processes, cellular stress response, and has been implicated in tumorigenesis. Its ability to regulate several cellular pathways places it at the forefront of cancer research. The study of the recombinant forms of these proteins—CLIC2/XAP12—provides essential insights into their structure-function relationships and interactions in various cellular contexts. By producing and characterizing these recombinant proteins, researchers aim to elucidate their biochemical properties, interactions with other cellular components, and potential as therapeutic targets. Investigating the combined roles of CLIC2 and XAP12 could reveal novel mechanisms of cellular regulation and contribute to the development of targeted therapies for diseases such as cancer, where both proteins exhibit dysregulation. Understanding how these proteins function in tandem may also reveal new insights into cellular homeostasis and the pathways involved in disease progression, ultimately aiming for innovative approaches in treatment strategies.
