Analytical Data
-
Gene name
PIGR
-
简介
PIGR proteins play a critical role in mediating the selective transcytosis of polymerized IgA and IgM across mucosal epithelial cells, which is critical for mucosal immunity. PIGR binds these immunoglobulins at the basolateral surface, forming a complex that is transported intracellularly and secreted apically. PIGR Protein, Human (HEK293, His) is the recombinant human-derived PIGR protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Polymeric Immunoglobulin Receptor; PIgR; Poly-Ig Receptor; Hepatocellular Carcinoma-Associated Protein TB6; PIGR
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01833
-
Expression Region
K19-R638, G365S
-
AA Sequence
KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSR
-
Protein Length
Extracellular Domain
-
Molecular Weight
88.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIGR, or Polymeric Immunoglobulin Receptor, is a key protein involved in the transport of immunoglobulins across epithelial cells, facilitating the secretion of immune antibodies, particularly IgA, into mucosal surfaces. The significance of PIGR in immune responses, mucosal immunity, and pathogen defense has garnered attention in recent years, especially considering its potential impact on vaccine development and therapeutic interventions. Research has shown that PIGR plays a vital role in maintaining the balance of immune responses in various mucosal tissues, including the gut, respiratory tract, and salivary glands. Abnormalities in PIGR expression or function have been linked to several immunological disorders and infectious diseases, highlighting the need for a deeper understanding of this receptor. Additionally, recombinant PIGR (rPIGR) generated through biotechnology offers promising avenues for investigating its mechanisms and functions, paving the way for new strategies in immunotherapy and vaccine design. By studying rPIGR's interactions with different immunoglobulins and its role in epithelial transport, researchers aim to elucidate its involvement in mucosal immunity, which could lead to novel therapeutic applications in treating infections and enhancing immune responses. The ongoing research into rPIGR not only enhances our understanding of mucosal biology but also promises to bridge gaps in developing effective vaccines and immunomodulatory therapies, making it a focal point in molecular immunology and translational medicine efforts.
