Analytical Data
-
Gene name
THSD1
-
简介
THSD1 protein actively regulates the assembly of nascent focal adhesions and affects the attachment of endothelial cells to the extracellular matrix. As a key player, THSD1 forms a complex with PTK2/FAK1, TLN1 and VCL and contributes to focal adhesion dynamics. THSD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived THSD1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Thrombospondin Type-1 Domain-Containing Protein 1; THSD1; TMTSP
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9JM61
-
Expression Region
E25-N412
-
AA Sequence
EYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVSVMLWEANTNRTLTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKSAFLKVEWPVFHIDLNRTAKAAEGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARASLGQPLEIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTGPIDLAQKFGYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPKRPEERTFQVAENRLPLGERRTVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNIETWGPWQPWSPCSTTCGDAVRERRRLCVTSFPSRPSCSGMSSETSPCSLEECAVFRPPGPSPVSPQDPVKSNN
-
Protein Length
Extracellular Domain
-
Molecular Weight
60-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
THSD1 (Thrombospondin Type-1 Domain Containing 1) is a protein that has garnered attention in recent years due to its potential role in various biological processes, including cell adhesion, migration, and angiogenesis. It is primarily expressed in the cardiovascular system, where it is believed to influence fibroblast activity and extracellular matrix remodeling. Research has suggested that THSD1 may be involved in tumorigenesis and cancer progression, as altered expression levels have been observed in several types of cancer, including breast and colorectal cancers. The generation of recombinant THSD1 protein has become an important tool in studying its functional mechanisms and interactions in cellular contexts. By producing and characterizing this protein, researchers aim to elucidate its role in disease processes and its potential as a biomarker or therapeutic target. Recent advancements in recombinant DNA technology have enabled the efficient production of THSD1 in various expression systems, facilitating detailed studies of its biological functions and implications in health and disease. Understanding THSD1's mechanisms could lead to novel insights into cancer biology and the development of innovative treatment strategies.
