Cat: IPD-X28087

Recombinant Human Calreticulin-3/CALR3 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Calreticulin-3/CALR3

  • 简介

    Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER)[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCalreticulin-3; Calreticulin-3; calreticulin-2; calsperin; CALR3; CRT2

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96L12

  • Expression Region

    T20-L384

  • AA Sequence

    TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    40-50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Calreticulin-3 (CALR3) is a member of the calreticulin family, which is characterized by its role in calcium binding and regulation within the endoplasmic reticulum. Its functions extend beyond calcium homeostasis; CALR3 is also involved in various cellular processes including cell adhesion, immune responses, and chaperone activity, thereby influencing cell signaling and survival. Research has shown that CALR3 plays a critical role in the modulation of immune responses, particularly in the context of cancer, where its expression levels may correlate with tumor progression and patient prognosis. This has sparked interest in developing CALR3 as a potential biomarker for cancer diagnosis and therapy. Moreover, the study of recombinant CALR3 proteins offers insights into their structural and functional properties, providing opportunities for therapeutic applications. Structural studies reveal how CALR3 interacts with other proteins and its role in calcium signaling pathways. The generation of recombinant CALR3 proteins allows for detailed investigation of these interactions, paving the way for therapeutic strategies that target CALR3-related pathways in diseases. Understanding the molecular mechanisms by which CALR3 influences cell behavior has significant implications for cancer research and therapy, making it a key target for further scientific exploration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US