Analytical Data
-
Gene name
Calreticulin-3/CALR3
-
简介
Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER)[1].
- Application
-
Alternative Names
rHuCalreticulin-3; Calreticulin-3; calreticulin-2; calsperin; CALR3; CRT2
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96L12
-
Expression Region
T20-L384
-
AA Sequence
TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
40-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Calreticulin-3 (CALR3) is a member of the calreticulin family, which is characterized by its role in calcium binding and regulation within the endoplasmic reticulum. Its functions extend beyond calcium homeostasis; CALR3 is also involved in various cellular processes including cell adhesion, immune responses, and chaperone activity, thereby influencing cell signaling and survival. Research has shown that CALR3 plays a critical role in the modulation of immune responses, particularly in the context of cancer, where its expression levels may correlate with tumor progression and patient prognosis. This has sparked interest in developing CALR3 as a potential biomarker for cancer diagnosis and therapy. Moreover, the study of recombinant CALR3 proteins offers insights into their structural and functional properties, providing opportunities for therapeutic applications. Structural studies reveal how CALR3 interacts with other proteins and its role in calcium signaling pathways. The generation of recombinant CALR3 proteins allows for detailed investigation of these interactions, paving the way for therapeutic strategies that target CALR3-related pathways in diseases. Understanding the molecular mechanisms by which CALR3 influences cell behavior has significant implications for cancer research and therapy, making it a key target for further scientific exploration.
