Analytical Data
-
Gene name
GM-CSF R alpha
-
简介
GM-CSF R alpha is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2. GM-CSF R alpha binds to the cytokine with high specificity and low affinity[1]. GM-CSF R alpha binds to GM-CSF and induces cell differentiation[2]. GM-CSF R alpha monoclonal antibody decreases GM-CSFRα expression on GM-CSF-responsive cells and shows anti-inflammatory activity in rheumatoid arthritis (RA)[3]. GM-CSF R alpha Protein, Human (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 320 amino acids (M1-G320) and is produced in HEK293 cells.
- Application
-
Alternative Names
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; GMR-alpha; CD116; CSF2RA; CSF2R; CSF2RY
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15509
-
Expression Region
E23-G320
-
AA Sequence
EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
-
Protein Length
Extracellular Domain
-
Molecular Weight
90 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Granulocyte-macrophage colony-stimulating factor receptor alpha (GM-CSF R alpha) is a critical component of the immune system, playing a pivotal role in hematopoiesis and the activation of immune cells such as neutrophils and macrophages. Research into GM-CSF R alpha has gained momentum due to its implications in various clinical conditions, including autoimmune diseases, cancer, and infectious diseases. The receptor, which binds GM-CSF, is integral to mediating its biological effects, including cell proliferation, differentiation, and survival. Understanding the signaling pathways and mechanisms of action related to GM-CSF R alpha is crucial for developing targeted therapies. Recombinant GM-CSF R alpha proteins have been produced to study these interactions in vitro and in vivo, providing insights into their functional roles and potential as therapeutic targets. The development of GM-CSF R alpha as a recombinant protein allows researchers to explore its structure-function relationships and its influence on immune responses, which may lead to novel interventions to modulate the immune system in various pathologies. Additionally, the characterization of GM-CSF R alpha can facilitate the design of antagonists or agonists that could fine-tune its activity, providing a promising avenue for both basic research and clinical applications. Overall, the ongoing studies on GM-CSF R alpha are essential for unraveling its complex biology and harnessing its potential for therapeutic benefits.











