Analytical Data
-
Gene name
CD158d/KIR2DL4
- Application
-
Alternative Names
rHuCD158d, His; Killer Cell Immunoglobulin-Like Receptor 2DL4; CD158 Antigen-Like Family Member D; KIR-103AS; MHC Class I NK Cell Receptor KIR103AS; CD158d; KIR2DL4; KIR103AS
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
ADY38409.1
-
Expression Region
W22-H242
-
AA Sequence
WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH
-
Protein Length
Partial
-
Molecular Weight
30-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD158d, also known as KIR2DL4 (Killer Immunoglobulin-like Receptor 2DL4), is a prominent member of the killer immunoglobulin-like receptor (KIR) family, primarily expressed on natural killer (NK) cells and certain T cells. Its unique structure features a longer cytoplasmic tail that is believed to play a crucial role in immune regulation. KIR2DL4 is noteworthy for its ability to recognize the non-classical MHC class I molecule HLA-G, which is involved in immune tolerance, particularly during pregnancy and in tumor immunity. Research on the recombinant protein of KIR2DL4 has gained momentum due to its potential applications in immunotherapy and its ability to modulate immune responses. Understanding the interactions between KIR2DL4 and HLA-G can provide insights into the mechanisms of immune evasion by tumors and the maintenance of fetal-maternal tolerance. Recent studies focus on the characterization of the recombinant protein's binding affinity, signaling pathways, and functional assays to elucidate its role in NK cell activation and inhibition. This research could contribute to the development of novel therapeutic strategies that harness the immune system's capabilities to combat cancers and improve transplant outcomes by managing immune tolerance. Moreover, elucidating the role of KIR2DL4 in different disease contexts may pave the way for personalized medicine approaches, allowing for tailored interventions based on individual immune profiles. This emerging field of study underscores the importance of CD158d/KIR2DL4 as a significant player in the immune landscape, providing a promising avenue for therapeutic innovation.
