Analytical Data
-
Gene name
STUB1
-
简介
STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90). STUB1 Protein, Human is the recombinant human-derived STUB1 protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
E3 Ubiquitin-Protein Ligase CHIP; Antigen NY-CO-7; CLL-Associated Antigen KW-8; Carboxy Terminus of Hsp70-Interacting Protein; STIP1 Homology and U Box-Containing Protein 1; STUB1; CHIP
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UNE7
-
Expression Region
M1-Y303
-
AA Sequence
MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
-
Protein Length
Full Length
-
Molecular Weight
33.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STUB1, also known as STUB1 or CHIP (C-terminus of Hsc70-interacting protein), is an E3 ubiquitin ligase that plays a crucial role in protein quality control within cells. It is involved in the regulation of protein homeostasis by mediating the ubiquitination and subsequent degradation of misfolded or damaged proteins through the ubiquitin-proteasome system. Research has highlighted STUB1's significance in various cellular processes, including stress responses, apoptosis, and the protection against neurodegenerative diseases. Mutations or dysregulation of STUB1 have been linked to conditions such as cancer and neurodegeneration, suggesting its vital role in maintaining cellular health. Therefore, the recombinant production of STUB1 protein is of paramount importance for understanding its functional mechanisms, interaction with substrate proteins, and its potential as a therapeutic target. Investigating the properties of STUB1, particularly through the use of recombinant techniques, can provide insights into its role in pathophysiological conditions and open new avenues for drug development aimed at enhancing cellular protein quality control mechanisms.
