Analytical Data
-
Gene name
ASAM/CLMP
-
简介
ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
CXADR-like membrane protein; Adipocyte-specific protein 5; Acam; Asp5; ASAM; CLMP
-
Species
Rat
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8K1G0
-
Expression Region
T18-M232
-
AA Sequence
THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM
-
Protein Length
Extracellular Domain
-
Molecular Weight
28-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASAM (ASPM and MUD) and CLMP (C-type lectin-like module protein) are significant proteins that have garnered attention in the context of developmental biology and immunology. ASAM is implicated in neuronal development and is believed to play a role in the regulation of neural stem cell proliferation and differentiation, while CLMP is known for its function in cellular adhesion and immune response modulation. The study of recombinant forms of these proteins is crucial for elucidating their functional properties, as well as their potential therapeutic applications. Recombinant protein technology allows for the production of these proteins in a controlled environment, facilitating detailed structural and functional analyses. This research is particularly relevant for understanding the molecular mechanisms underlying neurodevelopmental disorders and immune response irregularities. By expressing ASAM and CLMP as recombinant proteins, researchers can investigate their interactions with other cellular molecules and assess their impacts on signal transduction pathways. Additionally, such studies can pave the way for the development of novel therapeutic strategies that could target ASAM and CLMP pathways, thereby providing potential solutions for conditions related to neuronal dysfunction and abnormal immune responses. In summary, the exploration of ASAM and CLMP recombinant proteins represents a vital intersection of molecular biology, neurology, and immunology, contributing to a deeper understanding of their roles in health and disease.
