Analytical Data
-
Gene name
Plasma kallikrein/KLKB1
-
简介
Plasma kallikrein/KLKB1 enzymatically cleaves Lys-Arg and Arg-Ser bonds, triggering factor XII activation upon binding to a negatively charged surface.It liberates bradykinin from HMW kininogen and is implicated in the renin-angiotensin system, potentially converting prorenin into renin.This highlights the protein's multifaceted role in various physiological processes.Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Plasma kallikrein/KLKB1 protein, expressed by P.pastoris , with N-6*His labeled tag.
- Application
-
Alternative Names
Klkb1; Klk3; PkPlasma kallikrein; EC 3.4.21.34; Fletcher factor; Kininogenin
-
Species
Rat
-
Source
P. pastoris
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14272
-
Expression Region
I391-A638
-
AA Sequence
IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA
-
Protein Length
Partial
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Plasma kallikrein, also known as KLKB1, is a serine protease involved in the kallikrein-kinin system, which plays a critical role in various physiological processes, including blood pressure regulation, inflammation, and pain sensation. Abnormalities in KLKB1 function are associated with several pathological conditions, such as hereditary angioedema and cardiovascular diseases. The recombinant form of plasma kallikrein has emerged as a crucial tool for both basic research and therapeutic applications. Studies focusing on KLKB1 are driven by the need to understand its structure, function, and regulatory mechanisms better, as well as to explore its potential as a biomarker and therapeutic target. Advances in genetic engineering and protein expression systems have enabled the production of recombinant KLKB1, facilitating detailed investigations into its enzymatic activity, substrate specificity, and interaction with inhibitors. Furthermore, this research has implications for developing novel drugs that modulate the kallikrein-kinin system for treating related disorders. Overall, the study of recombinant plasma kallikrein/KLKB1 is pivotal for elucidating its role in health and disease, advancing biomedical research, and fostering innovative therapeutic strategies.











