Cat: IPD-X35713

Recombinant Human Langerin/CD207 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Langerin/CD207

  • 简介

    CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuC-type lectin domain family 4 member K/CD207, His; CD207 antigen; langerin; CD207; C-type lectin domain family 4 member K; C-type lectin domain family 4, member K

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    AAH22278.1

  • Expression Region

    Y64-P328

  • AA Sequence

    YPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

  • Protein Length

    Partial

  • Molecular Weight

    30-40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Langerin, also known as CD207, is a C-type lectin receptor predominantly expressed on Langerhans cells, which are specialized dendritic cells found in the skin and mucosal tissues. It plays a crucial role in the immune response by mediating the uptake of antigens and facilitating their presentation to T cells, thus linking innate and adaptive immunity. The study of Langerin/CD207 is significant as it is involved in various immunological processes, including skin immunity, pathogen recognition, and the modulation of allergic reactions. Researchers have shown that Langerin can bind to specific carbohydrates, allowing for the recognition of a wide range of pathogens, including viruses and fungi, which is essential for initiating effective immune responses. Moreover, the exploration of Langerin has potential therapeutic implications, such as the development of vaccines and immunotherapies, given its role in antigen uptake and processing. Recombinant Langerin/CD207 proteins have been produced for various studies to elucidate its structure-function relationships, investigate its binding mechanisms, and assess its potential in drug delivery systems. Understanding Langerin’s biology not only enhances our comprehension of skin immune responses but also offers insights into its role in diseases, including viral infections, autoimmune disorders, and allergies, which makes it a valuable target for future therapeutic developments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US