Analytical Data
-
Gene name
Thymopoietin
-
简介
Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42167
-
Expression Region
M1-E187
-
AA Sequence
PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
-
Protein Length
Partial
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Thymopoietin (TP) is a thymus-derived peptide that plays a crucial role in T-cell differentiation and immune regulation. Initially identified in the 1970s, TP has been found to influence various physiological processes, including the maturation of T lymphocytes, which are essential for adaptive immunity. Research has shown that TP can enhance T-cell proliferation and cytokine production, making it a potential candidate for therapeutic applications, particularly in immune deficiency and autoimmune diseases. The recombinant form of thymopoietin has been utilized in various studies to better understand its biological functions and mechanism of action. Advances in recombinant DNA technology have facilitated the production of TP, allowing researchers to generate sufficient quantities for both in vitro and in vivo experiments. By exploring its structural properties and interactions with immune cells, scientists aim to develop TP-based therapies that could enhance immune responses or serve as immunomodulators. The growing interest in TP and its recombinant forms reflects its potential as a novel therapeutic agent to improve immune function in clinical settings, suggesting that further research could lead to significant advancements in immunotherapy and regenerative medicine.











