Cat: IPD-X27599

Recombinant Human TUBB4A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TUBB4A

  • 简介

    TUBB4A protein, the main constituent of microtubules, forms cylindrical structures via lateral association of alpha- and beta-tubulin protofilaments. Microtubule growth, facilitated by GTP-tubulin dimers, leads to a stabilizing cap. Below this, TUBB4A dimers transition to a GDP-bound state, regulated by alpha-tubulin's GTPase activity. This intricate mechanism highlights TUBB4A's crucial role in governing microtubule assembly and stability. TUBB4A Protein, Human (His) is the recombinant human-derived TUBB4A protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tubulin Beta-4A Chain; Tubulin 5 Beta; Tubulin Beta-4 Chain; TUBB4A; TUBB4; TUBB5

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04350

  • Expression Region

    M1-A444

  • AA Sequence

    MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

  • Protein Length

    Full Length

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TUBB4A, a member of the beta-tubulin family, plays a crucial role in the formation and stability of microtubules, which are essential components of the cytoskeleton in eukaryotic cells. Mutations in the TUBB4A gene have been linked to various neurological disorders, including hypomyelinating leukodystrophy, which affects myelin sheath development in the central nervous system. Understanding TUBB4A’s structure and function has gained significant attention, as it can provide insights into the molecular mechanisms underlying these diseases. Researchers have focused on developing recombinant TUBB4A proteins to study their biochemical properties and interactions with other proteins. By producing TUBB4A in various expression systems, scientists aim to investigate how specific mutations alter its function, affecting microtubule dynamics and ultimately contributing to the pathophysiology of related disorders. This research not only enhances our understanding of TUBB4A itself but also contributes to the wider field of neurobiology and potential therapeutic avenues for diseases caused by cytoskeletal dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US