Analytical Data
-
Gene name
ASAM/CLMP
-
简介
ASAM/CLMP protein potentially participates in cell-cell adhesion, suggesting a role in adipocyte differentiation and obesity development. It is crucial for normal small intestine development, paralleling functions of related proteins. ASAM/CLMP Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
CXADR-like membrane protein; Adipocyte-specific protein 5; Acam; Asp5; ASAM; CLMP
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8R373
-
Expression Region
T18-M232
-
AA Sequence
THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM
-
Protein Length
Extracellular Domain
-
Molecular Weight
The protein migrates as 30-35 kDa under reducing SDS-PAGE due to glycosylation.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ASAM/CLMP (Adhesion-Related Mechanism of Astrocytic Migration/Cell Lineage Marker Protein) recombinant proteins has gained prominence due to their critical role in cellular adhesion and migration processes, particularly in the context of neural development and tissue regeneration. ASAM/CLMP belongs to the immunoglobulin superfamily and is implicated in various physiological functions, including the maintenance of tissue architecture and mediation of cell-to-cell interactions. Investigations have indicated that ASAM/CLMP may play a vital role in the pathophysiology of neurological disorders, such as neuroinflammation and neurodegenerative diseases, where alterations in cell adhesion mechanisms can adversely affect neural integrity and function. Recombinant forms of ASAM/CLMP facilitate detailed studies into its molecular properties and biological functions, providing insights into its interactions with other cellular proteins and pathways. Furthermore, understanding the signaling mechanisms of ASAM/CLMP can open avenues for therapeutic interventions aimed at enhancing neural repair and recovery following injury. Enhanced knowledge of ASAM/CLMP’s role in cellular processes not only enriches our understanding of neurobiology but also holds potential for developing novel strategies to combat neurological diseases through targeted modulation of cell adhesion properties. This research aligns with the broader objectives in regenerative medicine and neuroscience to harness and manipulate cellular behaviors for therapeutic purposes.
