Analytical Data
-
Gene name
SLAMF9
-
简介
SLAM family member 9 (Slamf9) is a member of the signaling lymphocytic activation molecule family. Slamf9 is a cell surface molecule that lacks the signal transduction motifs found in other family members. Slam9 acts mainly as a plasmacytoid dendritic cell (pDC) receptor and is essential for differentiation, function and maintenance of pDCs, and is also involved in the initiation of inflammation and clearance of bacterial infection. SLAMF9 Protein, Mouse (L224P, HEK293, His) is the recombinant mouse-derived SLAMF9 protein, expressed by HEK293 , with C-6*His labeled tag and L224P mutation.
- Application
-
Alternative Names
SLAM family member 9; Slamf9
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
BAB26328.1
-
Expression Region
F18-L230, L224P
-
AA Sequence
FSGDDEDPEEVVGVLQESINLSLEIPSNEEIKHIDWLFQNNIAIVKPGKKGQPAVIMAVDPRYRGRVSISESSYSLHISNLTWEDSGLYNAQVNLKTSESHITKSYHLRVYRRLSKPHITVNSNISEEGVCNISLTCSIERAGMDVTYIWLSSQDSTNTSHEGSVLSTSWRPGDKAPSYTCRVSNPISNISSRRISVGSFCADPGYPEKPSML
-
Protein Length
Partial
-
Molecular Weight
30-80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLAMF9 (Signaling Lymphocytic Activation Molecule Family Member 9) is a member of the SLAM family of proteins, which are involved in immune regulation and cell signaling. Recent studies have highlighted its critical role in modulating immune responses, particularly in relation to T cell activation and differentiation. Understanding the functional mechanisms of SLAMF9 is crucial, as it has been associated with various diseases, including autoimmune disorders and cancers. Research on recombinant SLAMF9 proteins aims to elucidate their structure and biological function, providing insights into the pathways that govern immune responses. By producing SLAMF9 in a recombinant form, scientists can investigate its interactions with other immune molecules, study its signaling pathways, and explore its potential as a therapeutic target or biomarker. Furthermore, recombinant SLAMF9 can be invaluable in developing diagnostic tools and novel immunotherapies, enhancing our ability to manipulate immune responses for better disease management. The background of this research emphasizes the importance of SLAMF9 in immunology and its promising role in advancing our understanding of immune-related diseases.
