Analytical Data
-
Gene name
CLEC-1
-
简介
CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Biological Activity
Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The ED50 for this effect is 1.492 μg/mL, corresponding to a specific activity is 670.241 units/mg. Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The ED50 for this effect is 1.492 μg/mL, corresponding to a specific activity is 670.241 units/mg.
-
Alternative Names
CLEC1A; C-type lectin domain family 1 member A; CLEC1
-
Species
Human
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8NC01
-
Expression Region
Q77-D280
-
AA Sequence
QLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD
-
Protein Length
Extracellular Domain
-
Molecular Weight
56.48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLEC-1, or C-type lectin domain family 1, has garnered significant attention in recent years due to its roles in immune response and potential therapeutic applications. As a cell surface receptor, CLEC-1 is primarily expressed in dendritic cells and macrophages, where it functions in recognizing specific pathogen-associated molecular patterns (PAMPs). Its interaction with various ligands initiates signaling pathways that modulate innate immune responses, aiding in the recognition of pathogens and the regulation of inflammation. Research has indicated that CLEC-1 plays a crucial role in dendritic cell maturation and cytokine production, influencing adaptive immune responses. Given its vital function in immune regulation, CLEC-1 has been explored as a potential target for vaccines and immunotherapies. Studies have also indicated associations between CLEC-1 activity and various diseases, including infections and autoimmune disorders. The recombinant expression of CLEC-1 protein allows for in-depth studies into its structure-function relationships and the mechanisms underlying its immune regulatory roles. By understanding its biological pathways and interactions, researchers aim to harness CLEC-1 in developing innovative strategies for disease management and therapeutic interventions. Consequently, CLEC-1 represents a promising avenue in immunology research, with implications extending to vaccine development and the treatment of immune-related diseases.











