Analytical Data
-
Gene name
MYOZ2
-
简介
MYOZ2 is a member of the Myozenin family that binds to Z-line proteins, including α-actin and γ-filamin, and contributes to the localization of calcineurin signals within the sarcomere. It plays a key role in regulating calcineurin signaling and has been shown to be involved in muscle regulatory mechanisms and myofibril formation. MYOZ2 Protein, Human (His) is the recombinant human-derived MYOZ2 protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
Myozenin-2; Calsarcin-1; FATZ-Related Protein 2; MYOZ2; C4orf5
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPC6
-
Expression Region
M1-L264
-
AA Sequence
MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL
-
Protein Length
Full Length
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYOZ2, a member of the myosin family, has garnered significant attention in recent years due to its potential roles in muscle physiology and disease pathology. This protein is predominantly expressed in skeletal and cardiac muscle tissues, suggesting its involvement in muscle contraction and overall muscular health. Research indicates that MYOZ2 may play a crucial role in regulating muscle development, maintenance, and regeneration. Recent studies have highlighted its interactions with other proteins involved in the sarcomere, the fundamental unit of muscle contraction, pointing to its importance in maintaining structural integrity and function within muscle fibers. Furthermore, dysregulation of MYOZ2 has been implicated in various muscle disorders, including cardiomyopathies and muscular dystrophies, making it a promising target for therapeutic intervention. Understanding the function and regulation of MYOZ2 at the molecular level can provide insights into the mechanisms underlying muscle diseases, advancing both diagnostic and treatment strategies. As such, elucidating the properties and interactions of MYOZ2 in the context of muscle biology represents a critical area of research with implications for developing novel approaches to combat muscle-related pathologies.
