Cat: IPD-X30910

Recombinant Mouse Carboxylesterase 1C Protein (P. pastoris),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Carboxylesterase 1C

  • 简介

    The carboxylesterase 1C protein is essential for xenobiotic detoxification and ester/amide prodrug activation, as well as participating in extracellular metabolism. Its multifunctional effects include processing of pulmonary surfactant. Carboxylesterase 1C Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Carboxylesterase 1C protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Carboxylesterase 1C; Ces N; Ces1c; Ee 1; Ee 4; Ee1; Es N; Es1; Es4; EsN; EST1C_MOUSE; Esterase 1; Liver carboxylesterase N; Lung surfactant convertase; PES-N; PESN

  • Species

    Mouse

  • Source

    P. pastoris

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23953

  • Expression Region

    H19-H550

  • AA Sequence

    HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Carboxylesterase 1C (CES1C) is an important enzyme belonging to the carboxylesterase family, which plays a critical role in the hydrolysis of various ester compounds, including drugs and environmental contaminants. Its ability to metabolize a wide range of substrates makes CES1C significant in pharmacokinetics and toxicology. The study of CES1C is particularly relevant in the context of drug metabolism, as variations in this enzyme's activity can influence the efficacy and safety of therapeutic agents. Moreover, CES1C has potential implications in understanding resistance to certain drugs and the metabolic activation of prodrugs. Research into recombinant CES1C offers insights into its structure-function relationships, enabling a more detailed examination of its catalytic mechanisms and substrate specificity. Furthermore, the production of recombinant CES1C can facilitate high-throughput screening of potential drug candidates and the investigation of drug-drug interactions. Understanding this enzyme's function at a molecular level could lead to improved drug design and personalized medicine approaches, highlighting its significance in biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US