Analytical Data
-
Gene name
HLP2/HPCAL1
-
简介
The HLP2/HPCAL1 protein emerged as a potential regulator of calcium-dependent rhodopsin phosphorylation, suggesting a role in regulating this critical process of visual signal transduction. Its complex interactions with calcium-mediated pathways suggest its importance in the precise control of rhodopsin function, influencing visual signaling. HLP2/HPCAL1 Protein, Human (His) is the recombinant human-derived HLP2/HPCAL1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
rHuHippocalcin-like protein 1/HPCAL1, His; Hippocalcin-Like Protein 1; Calcium-Binding Protein BDR-1; HLP2; Visinin-Like Protein 3; VILIP-3; HPCAL1; BDR1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37235
-
Expression Region
M1-F193
-
AA Sequence
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
-
Protein Length
Full Length
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLP2 (Hematopoietic-Lipoma Protein 2) and HPCAL1 (Atypical Calmodulin-Binding Protein 1) are proteins that have garnered significant interest due to their roles in cellular processes and potential implications in various diseases. HLP2 is primarily involved in hematopoiesis and may influence cell differentiation and proliferation, while HPCAL1 is known for its interactions with calcium ions and modulation of signaling pathways. Research has indicated that alterations in the expression levels or functionalities of these proteins can be linked to pathological conditions, including cancer and neurological disorders. Moreover, both proteins undergo complex regulatory mechanisms that contribute to their cellular functions. The development of recombinant forms of HLP2 and HPCAL1 allows for in-depth investigations into their structural characteristics and biological activities. This research is crucial for elucidating the mechanistic roles these proteins play in health and disease, paving the way for potential therapeutic strategies targeting their pathways. As such, studies focused on HLP2/HPCAL1 recombinant proteins not only enhance our understanding of their biological significance but also hold promise in identifying novel biomarkers and drug targets for clinical applications.
