Cat: IPD-X35576

Recombinant Human TLR4/CD284 Protein (Baculovirus),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TLR4/CD284

  • 简介

    TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD284; hToll; TLR-4; Toll like receptor 4 protein; TOLL

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00206-1

  • Expression Region

    E24-K631

  • AA Sequence

    ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

  • Protein Length

    Partial

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Toll-like receptor 4 (TLR4), also known as CD284, is a crucial component of the innate immune system, playing a pivotal role in recognizing pathogens and initiating immune responses. TLR4 is primarily known for its ability to detect lipopolysaccharides (LPS) from gram-negative bacteria, thereby triggering a cascade of inflammatory responses through the activation of downstream signaling pathways, including the MyD88-dependent and TRIF-dependent pathways. The importance of TLR4 in mediating immune responses makes it a significant target for research in immunology, vaccine development, and therapeutic interventions for various diseases, including sepsis, autoimmune disorders, and cancer. Recombinant TLR4/CD284 proteins are essential for studying the receptor's structure, function, and interactions with other molecules and for assessing the therapeutic potential of TLR4 modulation. By generating recombinant TLR4, researchers can analyze its role in immune signaling, investigate the effects of LPS and other agonists, and explore how TLR4 may be manipulated to enhance vaccine efficacy or attenuate harmful inflammatory responses. Furthermore, understanding TLR4/CD284 signaling pathways may provide insights into designing novel immunotherapeutics and adjuvants, making it a central topic in both fundamental and applied immunological research. The ongoing exploration of TLR4 reveals its significant implications for health and disease, highlighting the need for advanced studies utilizing recombinant proteins to elucidate its complex biology and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US