Analytical Data
-
Gene name
TLR4/CD284
-
简介
TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.
- Application
-
Alternative Names
CD284; hToll; TLR-4; Toll like receptor 4 protein; TOLL
-
Species
Human
-
Source
Baculovirus
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00206-1
-
Expression Region
E24-K631
-
AA Sequence
ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
-
Protein Length
Partial
-
Molecular Weight
68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Toll-like receptor 4 (TLR4), also known as CD284, is a crucial component of the innate immune system, playing a pivotal role in recognizing pathogens and initiating immune responses. TLR4 is primarily known for its ability to detect lipopolysaccharides (LPS) from gram-negative bacteria, thereby triggering a cascade of inflammatory responses through the activation of downstream signaling pathways, including the MyD88-dependent and TRIF-dependent pathways. The importance of TLR4 in mediating immune responses makes it a significant target for research in immunology, vaccine development, and therapeutic interventions for various diseases, including sepsis, autoimmune disorders, and cancer. Recombinant TLR4/CD284 proteins are essential for studying the receptor's structure, function, and interactions with other molecules and for assessing the therapeutic potential of TLR4 modulation. By generating recombinant TLR4, researchers can analyze its role in immune signaling, investigate the effects of LPS and other agonists, and explore how TLR4 may be manipulated to enhance vaccine efficacy or attenuate harmful inflammatory responses. Furthermore, understanding TLR4/CD284 signaling pathways may provide insights into designing novel immunotherapeutics and adjuvants, making it a central topic in both fundamental and applied immunological research. The ongoing exploration of TLR4 reveals its significant implications for health and disease, highlighting the need for advanced studies utilizing recombinant proteins to elucidate its complex biology and therapeutic potential.











