Cat: IPD-X23049

Recombinant Human Claudin-4/CLDN4 Protein-VLP Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Claudin-4/CLDN4 Protein-VLP

  • 简介

    Claudin-4/CLDN4 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein;

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14493

  • Expression Region

    M1-V209

  • AA Sequence

    MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

  • Protein Length

    Full Length

  • Molecular Weight

    23.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Claudin-4 (CLDN4) is a critical tight junction protein that plays a significant role in maintaining epithelial barrier integrity and regulating paracellular permeability. It is highly expressed in various tissues, including the gastrointestinal tract and pancreatic cells, and has been implicated in several diseases, including cancer. In particular, CLDN4 is of interest due to its upregulation in pancreatic ductal adenocarcinoma, making it a potential target for therapeutic intervention and diagnostic applications. The use of Virus-Like Particle (VLP) technology to produce recombinant proteins has gained attention for its ability to mimic natural viruses while being non-infectious. VLPs can present multiple copies of a target protein on their surface, enhancing immune responses and facilitating the study of protein interactions and functions. Research on CLDN4/CLDN4 Protein-VLP aims to leverage this technology for developing efficient vaccines or immunotherapeutics against cancers with CLDN4 overexpression. Additionally, VLPs offer a valuable platform for investigating the structure and function of CLDN4 in a controlled environment, aiding in the understanding of its role in cellular processes and pathogenesis. The combination of CLDN4 research with VLP technology holds promise for both therapeutic and diagnostic advancements, potentially leading to improved management strategies for diseases associated with altered CLDN4 expression.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US