Cat: IPD-X20399

Recombinant Mouse CD39 Protein(Baculovirus), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD39

  • 简介

    The CD39 protein is expressed in the nervous system and regulates purinergic neurotransmission by hydrolyzing ATP and other nucleotides. It also prevents platelet aggregation by hydrolyzing platelet-activated ADP to AMP. CD39 Protein, Mouse (sf9, His) is the recombinant mouse-derived CD39 protein, expressed by sf9 insect cells , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ectonucleoside triphosphate diphosphohydrolase 1; NTPDase 1; Ecto-apyrase; CD39; Entpd1

  • Species

    Mouse

  • Source

    Baculovirus

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55772

  • Expression Region

    T38-I478

  • AA Sequence

    TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYI

  • Protein Length

    Extracellular Domain

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD39, an enzyme belonging to the ecto-nucleoside triphosphate diphosphohydrolase family, plays a crucial role in regulating extracellular ATP levels and modulating immune responses. It catalyzes the hydrolysis of ATP to adenosine diphosphate (ADP) and subsequently to adenosine, which are vital in maintaining the balance between pro-inflammatory and anti-inflammatory signals in the immune system. Dysregulation of CD39 activity has been implicated in various pathological conditions, including autoimmune diseases, cancer, and chronic inflammation. The study of CD39 recombinant proteins has garnered significant attention as potential therapeutic targets, as they can facilitate understanding of CD39’s biological functions and mechanisms at a molecular level. Furthermore, engineering CD39 in recombinant form allows for the exploration of its enzymatic activity, binding properties, and effects on immune cell behavior. It also opens avenues for the development of novel immunotherapies, particularly for tumor microenvironments, where ATP levels are often elevated, contributing to immunosuppression.Overall, research on CD39 recombinant proteins is essential for deciphering its roles in health and disease, ultimately aiming to harness its potential for therapeutic applications and improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US