Analytical Data
-
Gene name
CD39
-
简介
The CD39 protein is expressed in the nervous system and regulates purinergic neurotransmission by hydrolyzing ATP and other nucleotides. It also prevents platelet aggregation by hydrolyzing platelet-activated ADP to AMP. CD39 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD39 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Ectonucleoside triphosphate diphosphohydrolase 1; NTPDase 1; NTPDase 1; Ecto-ATP diphosphohydrolase 1; Ecto-ATPDase 1; Ecto-ATPase 1; Ecto-apyrase; Lymphoid cell activation antigen; CD39
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55772
-
Expression Region
T38-I478
-
AA Sequence
TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYI
-
Protein Length
Extracellular Domain
-
Molecular Weight
60-90 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD39, an enzyme belonging to the ecto-nucleoside triphosphate diphosphohydrolase family, plays a crucial role in regulating extracellular ATP levels and modulating immune responses. It catalyzes the hydrolysis of ATP to adenosine diphosphate (ADP) and subsequently to adenosine, which are vital in maintaining the balance between pro-inflammatory and anti-inflammatory signals in the immune system. Dysregulation of CD39 activity has been implicated in various pathological conditions, including autoimmune diseases, cancer, and chronic inflammation. The study of CD39 recombinant proteins has garnered significant attention as potential therapeutic targets, as they can facilitate understanding of CD39’s biological functions and mechanisms at a molecular level. Furthermore, engineering CD39 in recombinant form allows for the exploration of its enzymatic activity, binding properties, and effects on immune cell behavior. It also opens avenues for the development of novel immunotherapies, particularly for tumor microenvironments, where ATP levels are often elevated, contributing to immunosuppression.Overall, research on CD39 recombinant proteins is essential for deciphering its roles in health and disease, ultimately aiming to harness its potential for therapeutic applications and improve patient outcomes.
